A11145
[KO Validated] CDK9 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A11145
- Zusätzliche Namen:
- C-2k|CDC2L4|CTK1|K9|PITALRE|TAK
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 42kDa/55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
- Uniprot:
- P50750
- Synonyme:
- C-2k;CDC2-related kinase;CDC2L4;cell division cycle 2-like protein kinase 4;cell division protein kinase 9;CTK1;cyclin-dependent kinase 9;PITALRE;serine/threonine protein kinase PITALRE;Serine/threonine-protein kinase PITALRE;TAK;tat-associated kinase complex catalytic subunit
- Weitere Details:
- The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS.
- Versandbedingungen:
- Blue Ice
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_1.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_2.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_3.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_4.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_5.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_ARC0527_WB_01.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_ARC0527_KO-WB_01.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_ARC0527_IHC_01.jpg)
![[KO Validated] CDK9 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11145/A11145_ARC0527_IHC_02.jpg)