A11136
[KO Validated] CDK4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A11136
- Zusätzliche Namen:
- CMM3|K4|PSK-J3
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 34kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
- Uniprot:
- P11802
- Synonyme:
- cell division protein kinase 4;CMM3;cyclin-dependent kinase 4;PSK-J3
- Weitere Details:
- The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.
- Versandbedingungen:
- Blue Ice
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_1.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_2.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_3.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_4.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_5.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_ARC51004-02_WB_01.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_ARC51004-02_KO-WB_01.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_ARC51004-01_IHC_07.jpg)
![[KO Validated] CDK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A11136/A11136_ARC51004-01_IHC_08.jpg)