A11128
PTEN Mouse monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A11128
- Zusätzliche Namen:
- 10q23del|BZS|CWS1|DEC|GLM2|MHAM|MMAC1|PTEN|PTEN1|PTENbeta|TEP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 54 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Mouse
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
- Uniprot:
- P60484
- Synonyme:
- 10q23del;BZS;CWS1;DEC;GLM2;MHAM;mitochondrial phosphatase and tensin protein alpha;mitochondrial PTENalpha;MMAC1;MMAC1 phosphatase and tensin homolog deleted on chromosome 10;mutated in multiple advanced cancers 1;Phosphatase and tensin homolog;phosphatase and tensin-like protein;phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN;phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN;protein tyrosine phosphatase;PTEN variant PTEN-K267Rfs*9;PTEN variant PTEN-L247*;PTEN variant PTEN-R234Afs*11;PTEN1;PTENbeta;PTENepsilon;TEP1
- Weitere Details:
- This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. The use of a non-canonical (CUG) upstream initiation site produces a longer isoform that initiates translation with a leucine, and is thought to be preferentially associated with the mitochondrial inner membrane. This longer isoform may help regulate energy metabolism in the mitochondria. A pseudogene of this gene is found on chromosome 9. Alternative splicing and the use of multiple translation start codons results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice



