IGFBP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A11109
Zusätzliche Namen:: AFBP|hIGFBP-1|IBP1|IGF-BP25|IGFBP1|PP12
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPN
Uniprot:: P08833
Synonyme:: AFBP;alpha-pregnancy-associated endometrial globulin;amniotic fluid binding protein;binding protein-25;binding protein-26;binding protein-28;growth hormone independent-binding protein;hIGFBP-1;IBP-1;IBP1;IGF-binding protein 1;IGF-BP25;IGFBP-1;insulin-like growth factor-binding protein 1;placental protein 12;PP12
Weitere Details:: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.

Versandbedingungen:: Blue Ice