A11070
AP2M1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A11070
- Zusätzliche Namen:
- AP2M1|AP50|CLAPM1|MRD60|mu2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK
- Uniprot:
- Q96CW1
- Synonyme:
- adaptin-mu2;adaptor protein complex AP-2 subunit mu;adaptor related protein complex 2 mu 1 subunit;adaptor-related protein complex 2 subunit mu;AP-2 complex subunit mu;AP-2 mu 2 chain;AP-2 mu chain;AP50;CLAPM1;clathrin adaptor complex AP2, mu subunit;clathrin assembly protein complex 2 medium chain;clathrin assembly protein complex 2 mu medium chain;clathrin coat adaptor protein AP50;clathrin coat assembly protein AP50;clathrin coat-associated protein AP50;clathrin-associated/assembly/adaptor protein, medium 1;HA2 50 kDA subunit;MRD60;mu2;plasma membrane adaptor AP-2 50 kDa protein;plasma membrane adaptor AP-2 50kDA protein
- Weitere Details:
- This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice