Glutaminase (GLS) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A11043
Zusätzliche Namen:: AAD20|CASGID|DEE71|EIEE71|GAC|GAM|GDPAG|GLS1|Glutaminase (GLS)|KGA
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55-65kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAP
Uniprot:: O94925
Synonyme:: AAD20;CASGID;DEE71;EIEE71;GAC;GAM;GDPAG;GLS1;glutaminase C;glutaminase kidney isoform, mitochondrial;glutaminase, phosphate-activated;K-glutaminase;KGA;L-glutamine amidohydrolase
Weitere Details:: This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants.