A10972
Lysozyme (LYZ) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A10972
- Zusätzliche Namen:
- Lysozyme (LYZ)|LYZF1|LZM
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
- Uniprot:
- P61626
- Synonyme:
- 1,4-beta-N-acetylmuramidase C;c-type lysozyme;lysozyme C;lysozyme F1;LYZF1;LZM
- Weitere Details:
- This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk,and is also present in spleen,lung,kidney,white blood cells,plasma,saliva,and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
- Versandbedingungen:
- Blue Ice