NTF4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1081
Zusätzliche Namen:: GLC10|GLC1O|NT-4|NT-4/5|NT-5|NT4|NT5|NTF4|NTF5
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Uniprot:: P34130
Synonyme:: GLC10;GLC1O;neurotrophic factor 4;neurotrophic factor 5;neurotrophin 5 (neurotrophin 4/5);neurotrophin-4;neurotrophin-5;neutrophic factor 4;NT-4;NT-4/5;NT-5;NT4;NT5;NTF5
Weitere Details:: This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood.