DEFB132 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1074
Zusätzliche Namen:: BD-32|DEFB-32|DEFB132|DEFB32|HEL-75|KFLL827|UNQ827
Anwendung:: ELISA, WB
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Uniprot:: Q7Z7B7
Synonyme:: BD-32;beta-defensin 132;beta-defensin 32;DEFB-32;DEFB32;defensin HEL-75;Defensin, beta 132;defensin, beta 32;HEL-75;KFLL827;RP5-1103G7.6;UNQ827
Weitere Details:: Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. This protein binds spermatozoa and has antimicrobial activity against E. coli. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13.