TNFRSF17 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10707
Zusätzliche Namen:: BCM|BCMA|CD269|TNFRSF13A|TNFRSF17
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 15-35kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
Uniprot:: Q02223
Synonyme:: B cell maturation antigen;B-cell maturation factor;B-cell maturation protein;BCM;BCMA;CD269;TNFRSF13A;tumor necrosis factor receptor superfamily member 17
Weitere Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.