CYBA Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10694
Zusätzliche Namen:: CGD4|CYBA|p22-PHOX
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
Uniprot:: P13498
Synonyme:: CGD4;cytochrome b light chain;cytochrome b-245 light chain;cytochrome b-245, alpha polypeptide;cytochrome b, alpha polypeptide;cytochrome b(558) alpha chain;cytochrome b(558) alpha-subunit;cytochrome b558 subunit alpha;flavocytochrome b-558 alpha polypeptide;neutrophil cytochrome b 22 kDa polypeptide;p22 phagocyte B-cytochrome;p22-PHOX;p22phox;superoxide-generating NADPH oxidase light chain subunit
Weitere Details:: Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.