CCL1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10670
Zusätzliche Namen:: CCL1|I-309|P500|SCYA1|SISe|TCA3
Anwendung:: ELISA, WB
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Uniprot:: P22362
Synonyme:: C-C motif chemokine 1;chemokine (C-C motif) ligand 1;I-309;inflammatory cytokine I-309;P500;SCYA1;SISe;small inducible cytokine A1 (I-309, homologous to mouse Tca-3);Small-inducible cytokine A1;T lymphocyte-secreted protein I-309;TCA3
Weitere Details:: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8.