A1067
LYZL6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1067
- Zusätzliche Namen:
- HEL-S-6a|LYC1|LYZB|LYZL6|PRO1485|TKAL754|UNQ754
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
- Uniprot:
- O75951
- Synonyme:
- epididymis secretory sperm binding protein Li 6a;HEL-S-6a;LYC1;lysozyme B;lysozyme homolog;lysozyme-like protein 6;LYZB;PRO1485;TKAL754;UNQ754
- Weitere Details:
- This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene.
- Versandbedingungen:
- Blue Ice