SLC35A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10658
Zusätzliche Namen:: CDG2F|CMPST|CST|hCST|SLC35A1
Anwendung:: ELISA, WB
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV
Uniprot:: P78382
Synonyme:: CDG2F;CMP-SA-Tr;CMP-Sia-Tr;CMP-sialic acid transporter;CMPST;CST;hCST;mutated CMP-sialic acid transporter A1;solute carrier family 35 (CMP-sialic acid transporter), member 1;solute carrier family 35 (CMP-sialic acid transporter), member A1;solute carrier family 35 (UDP-galactose transporter), member 1;Solute carrier family 35 member A1
Weitere Details:: The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene.