TDGF1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1065
Zusätzliche Namen:: CR|CR-1|CRGF|CRIPTO|TDGF1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 18kDa/20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPEL
Uniprot:: P13385
Synonyme:: CR;CR-1;CRGF;CRIPTO;cripto-1 growth factor;epidermal growth factor-like cripto protein CR1;teratocarcinoma-derived growth factor 1
Weitere Details:: This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.