Gsdma Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10602
Zusätzliche Namen:: Gsdm|Gsdm1|Gsdma|Gsdma1|H312E
Anwendung:: ELISA, WB
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQTLEGALDKGHEVTLEALPKDVLLSKDAMDAILYFLGALTVLSEAQ
Synonyme:: BB149167;FKSG9;gasdermin 1;gasdermin-1;gasdermin-A;gasdermin-A1;Gsd;Gsdm;Gsdm1;Gsdma1;H312E
Weitere Details:: Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Predicted to be involved in apoptotic process; defense response to bacterium; and pyroptosis. Predicted to act upstream of or within programmed cell death. Located in cytoplasm. Is expressed in esophagus epithelium; stomach; stomach cardiac region; stomach glandular region; and stomach glandular region mucosa. Orthologous to human GSDMA (gasdermin A).