A1058
14-3-3 epsilon Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1058
- Zusätzliche Namen:
- 14-3-3 epsilon|14-3-3E|HEL2|KCIP-1|MDCR|MDS
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 29-32Kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL
- Uniprot:
- P62258
- Synonyme:
- 14-3-3 epsilon;14-3-3 protein epsilon;14-3-3E;epididymis luminal protein 2;HEL2;KCIP-1;MDCR;MDS;mitochondrial import stimulation factor L subunit;protein kinase C inhibitor protein-1;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
- Weitere Details:
- This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.
- Versandbedingungen:
- Blue Ice







