BHLHE41 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10555
Zusätzliche Namen:: BHLHB3|BHLHE41|DEC2|FNSS1|hDEC2|SHARP1
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM
Uniprot:: Q9C0J9
Synonyme:: basic helix-loop-helix domain containing, class B, 3;BHLHB3;Class B basic helix-loop-helix protein 3;class E basic helix-loop-helix protein 41;DEC2;differentially expressed in chondrocytes protein 2;enhancer-of-split and hairy-related protein 1;FNSS1;hDEC2;SHARP1
Weitere Details:: This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. Defects in this gene are associated with the short sleep phenotype.