SEC11A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10552
Zusätzliche Namen:: 1810012E07Rik|SEC11A|SEC11L1|sid2895|SPC18|SPCS4A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF
Uniprot:: P67812
Synonyme:: 1810012E07Rik;endopeptidase SP18;microsomal signal peptidase 18 kDa subunit;SEC11 homolog A;SEC11-like protein 1;SEC11L1;sid2895;signal peptidase complex (18kD);signal peptidase complex 18;signal peptidase complex catalytic subunit SEC11A;SPase 18 kDa subunit;SPC18;SPCS4A
Weitere Details:: This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8.