TRIM24 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10546
Zusätzliche Namen:: hTIF1|PTC6|RNF82|TF1A|TIF1|TIF1A|TIF1ALPHA|TRIM24
Anwendung:: ELISA, WB
Molekulargewicht:: 117kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DGKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRK
Uniprot:: O15164
Synonyme:: E3 ubiquitin-protein ligase TRIM24;hTIF1;PTC6;RING finger protein 82;RING-type E3 ubiquitin transferase TIF1-alpha;RNF82;TF1A;TIF1;TIF1-alpha;TIF1A;TIF1ALPHA;transcription intermediary factor 1-alpha;transcriptional intermediary factor 1;Tripartite motif-containing protein 24
Weitere Details:: The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Versandbedingungen:: Blue Ice