A10509
MPP6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10509
- Zusätzliche Namen:
- MPP6|p55T|VAM-1|VAM1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 61kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKID
- Uniprot:
- Q9NZW5
- Synonyme:
- MAGUK p55 subfamily member 6;MAGUK protein p55T;membrane palmitoylated protein 6;membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6);MPP6;p55T;protein associated with Lin7 2;protein associated with LIN7 2, MAGUK family member;protein PALS2;VAM-1;VAM1;VELI-associated MAGUK 1
- Weitere Details:
- Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily (Tseng et al., 2001 [PubMed 11311936]).
- Versandbedingungen:
- Blue Ice

