A10503
FZD6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10503
- Zusätzliche Namen:
- FZ-6|FZ6|FZD6|HFZ6|NDNC1|NDNC10
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 79kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSF
- Uniprot:
- O60353
- Synonyme:
- frizzled 6, seven transmembrane spanning receptor;frizzled family receptor 6;frizzled homolog 6;frizzled-6;FZ-6;FZ6;HFZ6;NDNC1;NDNC10;seven transmembrane helix receptor
- Weitere Details:
- This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants, some of which do not encode a protein with a predicted signal peptide.
- Versandbedingungen:
- Blue Ice

