CSF2RB Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10501
Zusätzliche Namen:: betaGMR|CD131|CDw131|CSF2RB|IL3RB|IL5RB|SMDP5
Anwendung:: ELISA, WB
Molekulargewicht:: 95-120kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMW
Uniprot:: P32927
Synonyme:: beta common cytokine receptor;beta-GM-CSF receptor;betaGMR;CD131;CDw131;colony stimulating factor 2 receptor beta common subunit;colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage);colony-stimulating factor-2 receptor, beta, low-affinity;cytokine receptor common subunit beta;GM-CSF/IL-3/IL-5 receptor common beta subunit;GM-CSF/IL-3/IL-5 receptor common beta-chain;IL3RB;IL5RB;interleukin 3 receptor/granulocyte-macrophage colony stimulating factor 3 receptor, beta (high affinity);SMDP5
Weitere Details:: The protein encoded by this gene is the common beta chain of the high affinity receptor for IL-3, IL-5 and CSF. Defects in this gene have been reported to be associated with protein alveolar proteinosis (PAP).

Versandbedingungen:: Blue Ice