ANO1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10498
Zusätzliche Namen:: ANO1|DOG1|INDMS|ORAOV2|TAOS2|TMEM16A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 150kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVK
Uniprot:: Q5XXA6
Synonyme:: anoctamin 1, calcium activated chloride channel;anoctamin-1;Ca2+-activated Cl- channel;calcium activated chloride channel;discovered on gastrointestinal stromal tumors protein 1;DOG1;oral cancer overexpressed 2;Oral cancer overexpressed protein 2;ORAOV2;TAOS2;TMEM16A;Transmembrane protein 16A;transmembrane protein 16A (eight membrane-spanning domains);tumor-amplified and overexpressed sequence 2
Weitere Details:: Enables calcium activated cation channel activity; intracellular calcium activated chloride channel activity; and iodide transmembrane transporter activity. Involved in cation transport; inorganic anion transport; and positive regulation of insulin secretion involved in cellular response to glucose stimulus. Located in apical plasma membrane and nucleoplasm.