A10495
RASGRP1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10495
- Zusätzliche Namen:
- CALDAG-GEFI|CALDAG-GEFII|IMD64|RASGRP|RASGRP1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 90kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
- Uniprot:
- O95267
- Synonyme:
- calcium and DAG-regulated guanine nucleotide exchange factor II;calcium- and diacylglycerol-regulated guanine nucleotide exchange factor II;CALDAG-GEFI;CALDAG-GEFII;guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A;IMD64;ras activator RasGRP;RAS guanyl nucleotide-releasing protein 1;RAS guanyl releasing protein 1 (calcium and DAG-regulated);Ras guanyl-releasing protein;RAS guanyl-releasing protein 1;RASGRP
- Weitere Details:
- This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE).
- Versandbedingungen:
- Blue Ice




_WB_01.jpg)
_IF_01.jpg)
_IF_02.jpg)
_IF_03.jpg)