MTAP Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1049
Zusätzliche Namen:: BDMF|c86fus|DMSFH|DMSMFH|HEL-249|LGMBF|MSAP|MTAP
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Uniprot:: Q13126
Synonyme:: 5'-methylthioadenosine phosphorylase;BDMF;c86fus;DMSFH;DMSMFH;epididymis luminal protein 249;epididymis secretory sperm binding protein;HEL-249;LGMBF;MeSAdo phosphorylase;MSAP;MTA phosphorylase;MTAPase;S-methyl-5'-thioadenosine phosphorylase
Weitere Details:: This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage pathway of both adenine and methionine. The encoded enzyme is deficient in many cancers. Multiple alternatively spliced transcript variants have been described for this gene.