A10482
TREM2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10482
- Zusätzliche Namen:
- PLOSL2|TREM-2|TREM2|Trem2a|Trem2b|Trem2c
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
- Uniprot:
- Q9NZC2
- Synonyme:
- PLOSL2;TREM-2;Trem2a;Trem2b;Trem2c;triggering receptor expressed on monocytes 2;triggering receptor expressed on myeloid cells 2;triggering receptor expressed on myeloid cells 2a
- Weitere Details:
- This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice