PEX6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10459
Zusätzliche Namen:: HMLR2|PAF-2|PAF2|PBD4A|PDB4B|PEX6|PXAAA1
Anwendung:: ELISA, WB
Molekulargewicht:: 104kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
Uniprot:: Q13608
Synonyme:: HMLR2;PAF-2;PAF2;PBD4A;PDB4B;peroxin-6;peroxisomal AAA-type ATPase 1;Peroxisomal biogenesis factor 6;peroxisomal-type ATPase 1;peroxisome assembly factor 2;peroxisome biogenesis factor 6;PXAAA1
Weitere Details:: This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. Several transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice