SLC4A5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10436
Zusätzliche Namen:: NBC4|NBCe2|SLC4A5
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Uniprot:: Q9BY07
Synonyme:: electrogenic sodium bicarbonate cotransporter 4;NBC4;NBCe2;solute carrier family 4 (sodium bicarbonate cotransporter), member 5;Solute carrier family 4 member 5
Weitere Details:: This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarbonate transport. This protein is thought to be an integral membrane protein. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.