SEMA4F Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10432
Zusätzliche Namen:: M-SEMA|m-Sema-M|PRO2353|S4F|SEMA4F|SEMAM|SEMAW
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 83kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
Uniprot:: O95754
Synonyme:: M-SEMA;m-Sema-M;PRO2353;S4F;sema domain immunoglobulin domain transmembrane domain (TM) and short cytoplasmic domain (semaphorin) 4F;sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F;SEMAM;semaphorin M;semaphorin-4F;Semaphorin-M;semaphorin-W;SEMAW
Weitere Details:: This gene encodes a transmembrane class IV semaphorin family protein, which plays a role in neural development. This gene may be involved in neurogenesis in prostate cancer, the development of neurofibromas, and breast cancer tumorigenesis. Alternative splicing results in multiple transcript variants.