COLEC12 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10422
Zusätzliche Namen:: CLP1|COLEC12|NSR2|SCARA4|SRCL
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAA
Uniprot:: Q5KU26
Synonyme:: CLP1;collectin placenta protein 1;collectin sub-family member 12;collectin-12;hCL-P1;NSR2;nurse cell scavenger receptor 2;SCARA4;Scavenger receptor class A member 4;scavenger receptor class A, member 4;scavenger receptor with C-type lectin;SRCL
Weitere Details:: This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor that displays several functions associated with host defense. It can bind to carbohydrate antigens on microorganisms, facilitating their recognition and removal. It also mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein by vascular endothelial cells.