TREML1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10414
Zusätzliche Namen:: dJ238O23.3|GLTL1825|PRO3438|TLT-1|TLT1|TREML1
Anwendung:: ELISA, WB
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP
Uniprot:: Q86YW5
Synonyme:: dJ238O23.3;GLTL1825;PRO3438;TLT-1;TLT1;trem-like transcript 1 protein;triggering receptor expressed on myeloid cells-like protein 1
Weitere Details:: This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants