A1041
Exportin 2 (XPO2) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A1041
- Zusätzliche Namen:
- CAS|CSE1|Exportin 2 (XPO2)|XPO2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 105kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
- Uniprot:
- P55060
- Synonyme:
- CAS;cellular apoptosis susceptibility protein;chromosome segregation 1-like protein;CSE1;CSE1 chromosome segregation 1-like;epididymis secretory sperm binding protein;exp2;exportin-2;importin-alpha re-exporter;XPO2
- Weitere Details:
- CSE1L (Chromosome Segregation 1-Like) is located on 20q13.13, and encodes a 971-amino-acid protein. It associates with microtubules and mitotic spindles, and is also considered to have a role in tumor progression. The CSE1L protein includes a nuclear localization signal allowing for transport into the nucleus via the importin-alpha/beta heterodimer. In addition, CSE1L plays roles in cell proliferation and apoptosis.
- Versandbedingungen:
- Blue Ice