MMP16 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10409
Zusätzliche Namen:: C8orf57|MMP-X2|MMP16|MT-MMP2|MT-MMP3|MT3-MMP
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAI
Uniprot:: P51512
Synonyme:: C8orf57;matrix metallopeptidase 16 (membrane-inserted);matrix metalloproteinase-16;membrane-type matrix metalloproteinase 3;membrane-type-3 matrix metalloproteinase;MMP-16;MMP-X2;MT-MMP 3;MT-MMP2;MT-MMP3;MT3-MMP;MT3MMP;MTMMP3;Putative transmembrane protein C8orf57
Weitere Details:: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

Versandbedingungen:: Blue Ice