A10408
UBE2G2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10408
- Zusätzliche Namen:
- UBC7|UBE2G2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 19kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
- Uniprot:
- P60604
- Synonyme:
- E2 ubiquitin-conjugating enzyme G2;UBC7;ubiquitin carrier protein G2;ubiquitin conjugating enzyme 7;ubiquitin conjugating enzyme G2;ubiquitin-conjugating enzyme E2 G2;ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7);ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast);ubiquitin-protein ligase G2
- Weitere Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



