UBE2G2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10408
Zusätzliche Namen:: UBC7|UBE2G2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Uniprot:: P60604
Synonyme:: E2 ubiquitin-conjugating enzyme G2;UBC7;ubiquitin carrier protein G2;ubiquitin conjugating enzyme 7;ubiquitin conjugating enzyme G2;ubiquitin-conjugating enzyme E2 G2;ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7);ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast);ubiquitin-protein ligase G2
Weitere Details:: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Versandbedingungen:: Blue Ice