A10404
CORIN Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10404
- Zusätzliche Namen:
- ATC2|CORIN|CRN|Lrp4|PEE5|TMPRSS10
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 116kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS
- Uniprot:
- Q9Y5Q5
- Synonyme:
- ATC2;atrial natriuretic peptide-converting enzyme;Corin;CRN;heart-specific serine proteinase ATC2;Lrp4;PEE5;pro-ANP-convertase;pro-ANP-converting enzyme;TMPRSS10;transmembrane protease serine 10
- Weitere Details:
- This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice