A10402
YME1L1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10402
- Zusätzliche Namen:
- FTSH|MEG4|OPA11|PAMP|YME1L|YME1L1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSEPSLNLRDLGLSELKIGQIDQLVENLLPGFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLIL
- Uniprot:
- Q96TA2
- Synonyme:
- ATP-dependent metalloprotease FtsH1;ATP-dependent metalloprotease FtsH1 homolog;ATP-dependent zinc metalloprotease YME1L1;FTSH;meg-4;MEG4;OPA11;PAMP;presenilin-associated metalloprotease;YME1-like protein 1;YME1L
- Weitere Details:
- The protein encoded by this gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Three transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice