A10361
NOP14 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10361
- Zusätzliche Namen:
- C4orf9|NOL14|NOP14|RES4-25|RES425|UTP2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 115kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNMSPEEKMMKRFALEQQRHHEKKSIYNLNEDEELTHYGQSLADIEKHNDIVDSDSDAEDRGTLSAELTAAHFGGGGGLLHKKTQQEGEEREKPKSRKELIEELIAKSKQEKRERQAQREDALELTEKLDQDWKEIQTLLSHKTPKSE
- Uniprot:
- P78316
- Synonyme:
- C4orf9;NOL14;NOP14 nucleolar protein homolog;Nucleolar complex protein 14;nucleolar protein 14;probable nucleolar complex protein 14;RES4-25;RES425;UTP2
- Weitere Details:
- This gene encodes a protein that plays a role in pre-18s rRNA processing and small ribosomal subunit assembly. The encoded protein may be involved in the regulation of pancreatic cancer cell proliferation and migration. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice