MMACHC Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10355
Zusätzliche Namen:: cblC|MMACHC
Anwendung:: ELISA, WB
Molekulargewicht:: 32kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP
Uniprot:: Q9Y4U1
Synonyme:: alkylcobalamin:glutathione S-alkyltransferase;cblC;cyanocobalamin reductase (cyanide-eliminating);cyanocobalamin reductase / alkylcobalamin dealkylase;methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria;methylmalonic aciduria and homocystinuria type C protein
Weitere Details:: The exact function of the protein encoded by this gene is not known, however, its C-terminal region shows similarity to TonB, a bacterial protein involved in energy transduction for cobalamin (vitamin B12) uptake. Hence, it is postulated that this protein may have a role in the binding and intracellular trafficking of cobalamin. Mutations in this gene are associated with methylmalonic aciduria and homocystinuria type cblC.