A10349
DAB1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10349
- Zusätzliche Namen:
- DAB1|SCA37
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 57kDa/59kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVY
- Uniprot:
- O75553
- Synonyme:
- Dab reelin signal transducer 1;Dab, reelin signal transducer, homolog 1;DAB1, reelin adaptor protein;disabled homolog 1;SCA37
- Weitere Details:
- The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain.
- Versandbedingungen:
- Blue Ice