A10337
SNX18 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10337
- Zusätzliche Namen:
- SH3PX2|SH3PXD3B|SNAG1|SNX18
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKYDSV
- Uniprot:
- Q96RF0
- Synonyme:
- SH3 and PX domain-containing protein 3B;SH3PX2;SH3PXD3B;SNAG1;sorting nexin associated golgi protein 1;sorting nexin-18;sorting nexin-associated Golgi protein 1
- Weitere Details:
- This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice