STRIP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10334
Zusätzliche Namen:: FAM40A|FAR11A|STRIP1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ
Uniprot:: Q5VSL9
Synonyme:: FAM40A;family with sequence similarity 40, member A;FAR11 factor arrest 11 homolog A;FAR11A;homolog of yeast FAR11 protein 1;protein FAM40A;striatin-interacting protein 1
Weitere Details:: This gene encodes a member of the striatin-interacting phosphatase and kinase complex, which is involved in localization of the Golgi body. The encoded protein participates in cytosketelal organization. Alternative splicing results in multiple transcript variants.