A10294
SNAPIN Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10294
- Zusätzliche Namen:
- BLOC1S7|BLOS7|BORCS3|SNAPAP|SNAPIN
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
- Uniprot:
- O95295
- Synonyme:
- biogenesis of lysosomal organelles complex-1, subunit 7;biogenesis of lysosome-related organelles complex 1 subunit 7;BLOC-1 related complex subunit 3;BLOC-1 subunit 7;BLOC1S7;BLOS7;BORCS3;SNAP-25-binding protein;SNAPAP;SNARE associated protein snapin;SNARE-associated protein Snapin;synaptosomal-associated protein 25-binding protein
- Weitere Details:
- The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice