KCNMB2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10277
Zusätzliche Namen:: KCNMB2
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSN
Uniprot:: Q9Y691
Synonyme:: big potassium channel beta subunit 2;BK channel beta subunit 2;BK channel subunit beta-2;calcium-activated potassium channel subunit beta-2;Calcium-activated potassium channel, subfamily M subunit beta-2;charybdotoxin receptor subunit beta-2;hbeta2;Hbeta3;hCG1646471;k(VCA)beta-2;large conductance calcium-activated potassium channel beta 2 subunit;large-conductance Ca2+-activated K+ channel beta2 subunit;Maxi K channel subunit beta-2;MaxiK channel beta 2 subunit;MaxiK channel beta-subunit 2;potassium channel subfamily M regulatory beta subunit 2;potassium large conductance calcium-activated channel, subfamily M, beta member 2;slo-beta-2
Weitere Details:: MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.

Versandbedingungen:: Blue Ice