USP13 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10264
Zusätzliche Namen:: IsoT-3|ISOT3|USP13
Anwendung:: ELISA, WB
Molekulargewicht:: 97kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN
Uniprot:: Q92995
Synonyme:: deubiquitinating enzyme 13;Isopeptidase T-3;IsoT-3;ISOT3;ubiquitin carboxyl-terminal hydrolase 13;ubiquitin specific peptidase 13 (isopeptidase T-3);ubiquitin specific protease 13 (isopeptidase T-3);ubiquitin thioesterase 13;ubiquitin thiolesterase 13;ubiquitin-specific-processing protease 13
Weitere Details:: Enables several functions, including BAT3 complex binding activity; chaperone binding activity; and cysteine-type peptidase activity. Involved in several processes, including maintenance of unfolded protein involved in ERAD pathway; regulation of cellular catabolic process; and regulation of transcription, DNA-templated. Acts upstream of or within protein deubiquitination and protein stabilization. Predicted to be located in nucleoplasm. Predicted to be active in cytosol and nucleus.