eIF2B epsilon (EIF2B5) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10263
Zusätzliche Namen:: CACH|CLE|EIF-2B|eIF2B epsilon (EIF2B5)|EIF2Bepsilon|LVWM
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 85kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSEDD
Uniprot:: Q13144
Synonyme:: CACH;CLE;EIF-2B;eIF-2B GDP-GTP exchange factor subunit epsilon;EIF2Bepsilon;eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa;LVWM;translation initiation factor eIF-2B subunit epsilon
Weitere Details:: This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.