XPNPEP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10255
Zusätzliche Namen:: AEACEI|APP2|XPNPEP2
Anwendung:: ELISA, WB
Molekulargewicht:: 76kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
Uniprot:: O43895
Synonyme:: AEACEI;aminoacylproline aminopeptidase;APP2;mAmP;membrane-bound aminopeptidase P;membrane-bound AmP;membrane-bound APP;X-Pro aminopeptidase 2;X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound;xaa-Pro aminopeptidase 2
Weitere Details:: Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes.