A10247
SLC25A1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10247
- Zusätzliche Namen:
- CIC|CMS23|CTP|D2L2AD|SEA|SLC20A3|SLC25A1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 34kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD
- Uniprot:
- P53007
- Synonyme:
- citrate transport protein;CMS23;CTP;D2L2AD;SEA;SLC20A3;solute carrier family 20 (mitochondrial citrate transporter), member 3;solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1;Solute carrier family 25 member 1;tricarboxylate carrier protein;tricarboxylate transport protein, mitochondrial
- Weitere Details:
- This gene encodes a member of the mitochondrial carrier subfamily of solute carrier proteins. Members of this family include nuclear-encoded transporters that translocate small metabolites across the mitochondrial membrane. This protein regulates the movement of citrate across the inner membranes of the mitochondria. Mutations in this gene have been associated with combined D-2- and L-2-hydroxyglutaric aciduria. Pseudogenes of this gene have been identified on chromosomes 7, 11, 16, and 19. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice







