A10217
GPER1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10217
- Zusätzliche Namen:
- CEPR|CMKRL2|DRY12|FEG-1|GPCR-Br|GPER|GPER1|GPR30|LERGU|LERGU2|LyGPR|mER
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
- Uniprot:
- Q99527
- Synonyme:
- CEPR;chemoattractant receptor-like 2;chemokine receptor-like 2;CMKRL2;constitutively expressed peptide-like receptor;DRY12;FEG-1;flow-induced endothelial G-protein coupled receptor 1;G protein-coupled estrogen receptor 1;G protein-coupled receptor 30;G-protein coupled estrogen receptor 1;G-protein coupled receptor 30;GPCR-Br;GPER;GPR30;heptahelix receptor;IL8-related receptor DRY12;LERGU;LERGU2;LyGPR;lymphocyte-derived G-protein coupled receptor;membrane estrogen receptor;mER
- Weitere Details:
- This gene encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum and a member of the G-protein coupled receptor 1 family. This receptor binds estrogen and activates multiple downstream signaling pathways, leading to stimulation of adenylate cyclase and an increase in cyclic AMP levels, while also promoting intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. This receptor has been shown to play a role in diverse biological processes, including bone and nervous system development, metabolism, cognition, male fertility and uterine function.
- Versandbedingungen:
- Blue Ice