DIAPH2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10209
Zusätzliche Namen:: DIA|DIA2|DIAPH2|DRF2|POF|POF2|POF2A
Anwendung:: ELISA, WB
Molekulargewicht:: 125kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
Uniprot:: O60879
Synonyme:: DIA;DIA2;diaphanous homolog 2;Diaphanous-related formin-2;diaphorase-2;DRF2;POF;POF2;POF2A;protein diaphanous homolog 2
Weitere Details:: The product of this gene belongs to the diaphanous subfamily of the formin homology family of proteins. This gene may play a role in the development and normal function of the ovaries. Defects in this gene have been linked to premature ovarian failure 2. Alternatively spliced transcript variants encoding different isoforms have been identified.